PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G276200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family SRS
Protein Properties Length: 368aa    MW: 38670.6 Da    PI: 8.2964
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G276200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702210.44.7e-651413003154
              DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklss 93 
                         s t++C+dCGnqakkdC+h+RCRtCCksrgfdCathvkstWv+aa+rrerq   a+a   a ++ +++ sk++r   +++++++s+t++s+
  Potri.001G276200.1 141 SATTTCEDCGNQAKKDCSHRRCRTCCKSRGFDCATHVKSTWVAAARRRERQLI-ATAGGGAGSTGSTSGSKKPRLI-NSQATTTSHTSTSN 229
                         57899********************************************9655.4555666777788999999975.788899999***** PP

              DUF702  94 aeskkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                         ++++++ +tss          lP +v ++avfrcvrv++v+dge+++aYq++v+igGhvfkG+LydqG+e+
  Potri.001G276200.1 230 TTPPRSYDTSSshqdagfkerLPVQVTAPAVFRCVRVTAVEDGEDQYAYQAVVKIGGHVFKGFLYDQGVET 300
                         ********9999********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.5E-60143299IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.3E-25145187IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016247.3E-29250298IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MVGLRDVFVV APAAPFNHHH HHHHQHHEQI NLSTADPINA SNATALGVGV GVGVIPLLTS  60
APCLTPQNMD DQDLLHNGRN KISGIHQFWQ NQGTQYIKKA SDTTHSIIDH HNNSSTANFL  120
LQSGNGGGNG SGNLGGNSSS SATTTCEDCG NQAKKDCSHR RCRTCCKSRG FDCATHVKST  180
WVAAARRRER QLIATAGGGA GSTGSTSGSK KPRLINSQAT TTSHTSTSNT TPPRSYDTSS  240
SHQDAGFKER LPVQVTAPAV FRCVRVTAVE DGEDQYAYQA VVKIGGHVFK GFLYDQGVET  300
RDGFPNISEL HLGAANGGGG GGAGRHGASS SPILDPSDVY GASAGGLLGG RRAVIDVECP  360
WYKTETR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.87200.0bud| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011024964.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like isoform X1
SwissprotQ94CK93e-87LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLB9GG871e-180B9GG87_POPTR; Uncharacterized protein
STRINGPOPTR_0001s28290.11e-179(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Representative plantOGRP13131549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.21e-72Lateral root primordium (LRP) protein-related